![](https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEggLaFpXmsHnfhVyE0nxIgAeCe6WoyRfe47XLy6RIBcyPWVg4eAqqUCu5QXp0X3mLKbjZXevpsKjP3YKVH6M3nAJXw2ChFPCMXaezrFyQ2TOEgle2rNB5TzDuYSgqkactIkis9DYqct42I/s320/Villus.png)
Enterocytes are produced by division of stem cells at the bottom of the crypts that are in the valleys between the villi that project into the lumen where the digesting food is. New enterocytes are added at the base of the villi and old enterocytes are sloughed off at the top of the villi. As the new enterocytes move up the villi, they differentiate to produce the dramatic surface of microvilli, the furry brush border that further expands their surface area. The mature enterocytes produce transport proteins on their microvilli to take up sugars, amino acids and fats. The small nutrient molecules pass through the base of the enterocytes and bath the cells below, the lamina propia. The nutrients enter the capillaries of the villi and travel to the liver. Fats are transported through the lymphatic system.
Bacteria that slip through the enterocyte layer encounter macrophages and other types of white blood cells of the lamina propia. Among these cells are the Paneth cells. Fragments of the cell walls of bacteria bind to the NOD proteins of the Paneth cells and trigger the secretion of antimicrobial peptides, the cryptidins. Cryptidins are antimicrobial because of their array of basic amino acids surrounded by hydrophobic amino acids. These short proteins are able to disrupt the membrane function of most bacteria. I think they work on bacteria the same way that amyloid proteins, e.g. amyloid plaque proteins of Alzheimer’s disease, kill human cells. In fact, amyloid fibers bind to heparin and so do antibiotic peptides.
Here is an example of an antibiotic peptide, cryptidin 4,
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
Note the pairs of basic amino acids (blue). These amino acids are necessary for toxicity to bacteria. Heparin binding domains from proteins are
![](https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEj8y-_CCQMfTH-aQb46p-cdnaLybj7ealC5_HSx3FGuzvSiVGYbNeeQmkmpv-w5nWrv-yP0TdHaxlwP5VMNSrr-rEnmYyPIKh9llK05BFmYRbrTrAUMSHka4Jz-Mue5e6YEPfbH5H5JHWg/s320/cryptdin1.jpg)
With each meal, the fat content normally stimulates the production of a hormone, cholecystokinin, that binds to a receptor and causes an anti-inflammatory release of cytokines from the vagus nerves that reach the villi. Thus, food normally makes the intestines more tolerant of food antigens.
If the intestines become chronically inflamed, then exposure to normal probiotic bacteria can lead to cycles of inflammation that damage the integrity of the intestines. The intestines lose the ability to discriminate between probiotic and pathogen.
![](https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEij2pIdMj34GlCPgKXjBvjJD9BbnRSJLBYm7O5UWFsxkRdih9Koprsp8XzX_2MTFt33qD_S61D98EpLV_oFvelcaiv5NoPZyvfiv0hW4ZiZB9D5oxBZQYYroQ4prme3lW4z3slv-Wxb94Y/s320/CrohnsPatterns.png)
Crohn’s disease is an inflammatory, autoimmune disease of the bowel. The chronic inflammation of the lamina propia eliminate the ability of the Paneth cells to produce cryptidins and bacteria set up residence in the crypts and cause continual inflammation. This disease is typically treated by suppressing inflammation and treating with antibiotics.
Other treatment approaches that have been found effective are omega-3 oils to stimulate production of anti-inflammatory prostaglandins, pre- and probiotics, heparin and helminth eggs, e.g. wireworm.
Crohn’s disease would seem to benefit from the standard recommendation of an anti-inflammatory diet and lifestyle.
4 comments:
This article is filled with more than enough content, utmost valuable for a newbie in the field like me! Anyways, hearty regards.
All thanks to this great herbal doctor who cured me from (LUPUS DISEASE) his name is dr imoloa. I suffered lupus disease for over 8 years with pains like: joints, Skin rash, Pain in the chest, swollen joints and many more. The anti-inflammatory drugs couldn’t cure me, until I read about his recommendation. 2 months ago, I contacted him through his email address. drimolaherbalmademedicine@gmail.com . and he sent me the herbal treatment through DHL courier service and he instructed me on how to drink it for good two weeks. after then, And I was confirmed cured and free at the hospital after taken his powerful herbal medications You too can be cured with it if interested, he also uses his powerful herbal healing medicine to cure disease like:parkison disease, vaginal cancer, epilepsy, Anxiety Disorders, Autoimmune Disease, Back Pain, Back Sprain, Bipolar Disorder, Brain Tumour, Malignant, Bruxism, Bulimia, Cervical Disk Disease, cardiovascular disease, Neoplasms, chronic respiratory disease, mental and behavioural disorder, Cystic Fibrosis, Hypertension, Diabetes, asthma, Inflammatory autoimmune-mediated arthritis. chronic kidney disease, inflammatory joint disease, back pain, impotence, feta alcohol spectrum, Dysthymic Disorder, Eczema, skin cancer, tuberculosis, Chronic Fatigue Syndrome, constipation, inflammatory bowel disease, bone cancer, lungs cancer, mouth ulcer, mouth cancer, body pain, fever, hepatitis A.B.C., syphilis, diarrhea, HIV/AIDS, Huntington's Disease, back acne, Chronic renal failure, addison disease, Chronic Pain, Crohn's Disease, Cystic Fibrosis, Fibromyalgia, Inflammatory Bowel Disease, fungal nail disease, Lyme Disease, Celia disease, Lymphoma, Major Depression, Malignant Melanoma, Mania, Melorheostosis, Meniere's Disease, Mucopolysaccharidosis , Multiple Sclerosis, Muscular Dystrophy, Rheumatoid Arthritis, Alzheimer's Disease Contacts him today and get permanently cure. contact him via... email- drimolaherbalmademedicine@gmail.com /whatssapp-+2347081986098.
The OnlyFans account is a service page onlyfans free account
¡Oh Dios mío! ¡Impresionante artículo, amigo! Muchas gracias, sin embargo estoy teniendo problemas con
su RSS. No sé por qué no puedo unirme. ¿Alguien tiene problemas de RSS similares?
Cualquiera que conozca la solución puede responder amablemente?
¡¡Gracias!! 먹튀사이트
Post a Comment